PVRL2 (Human) Recombinant Protein
  • PVRL2 (Human) Recombinant Protein

PVRL2 (Human) Recombinant Protein

Ref: AB-H00005819-G01
PVRL2 (Human) Recombinant Protein

Información del producto

Human PVRL2 full-length ORF (NP_002847.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name PVRL2
Gene Alias CD112|HVEB|PRR2|PVRR2
Gene Description poliovirus receptor-related 2 (herpesvirus entry mediator B)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 5819

Enviar un mensaje


PVRL2 (Human) Recombinant Protein

PVRL2 (Human) Recombinant Protein