PTPRE (Human) Recombinant Protein Ver mas grande

PTPRE (Human) Recombinant Protein

AB-H00005791-G01

Producto nuevo

PTPRE (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Hoja técnica

Size 10 ug
Gene Name PTPRE
Gene Alias DKFZp313F1310|FLJ57799|FLJ58245|HPTPE|PTPE|R-PTP-EPSILON
Gene Description protein tyrosine phosphatase, receptor type, E
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEPLCPLLLVGFSLPLARALRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLLLLVLLLAAYFFRFRKQRKAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGTFELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGPKQETVNDFWRMVWEQKSATIVMLTNLKERKEEKCHQYWPDQGCWT
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 5791

Más información

Human PTPRE full-length ORF (ADZ16048.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).

Consulta sobre un producto

PTPRE (Human) Recombinant Protein

PTPRE (Human) Recombinant Protein