QSOX1 (Human) Recombinant Protein
  • QSOX1 (Human) Recombinant Protein

QSOX1 (Human) Recombinant Protein

Ref: AB-H00005768-G01
QSOX1 (Human) Recombinant Protein

Información del producto

Human QSOX1 full-length ORF (ADZ16009.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name QSOX1
Gene Alias FLJ34858|Q6|QSCN6
Gene Description quiescin Q6 sulfhydryl oxidase 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MRRCNSGSGPPPSLLLLLLWLLAVPGANAAPRSALYSPSDPLTLLQADTVRGAVLGSRSAWAVEFFASWCGHCIAFAPTWKALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFFARNNEEYLALIFEKGGSYLAREVALDLSQHKGVAVRRVLNTEANVVRKFGVTDFPSCYLLFRNGSVSRVPVLMES
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 5768

Enviar un mensaje


QSOX1 (Human) Recombinant Protein

QSOX1 (Human) Recombinant Protein