PTH2R (Human) Recombinant Protein
  • PTH2R (Human) Recombinant Protein

PTH2R (Human) Recombinant Protein

Ref: AB-H00005746-G01
PTH2R (Human) Recombinant Protein

Información del producto

Human PTH2R full-length ORF (ADR82689.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name PTH2R
Gene Alias PTHR2
Gene Description parathyroid hormone 2 receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MAGLGASLHVWGWLMLGSCLLARAQLDSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLYVMYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIHMHLFVSFMLRATSIFVKDRVVHAHIGVKELESLIMQDDPQNSIEATSVDKSQYIGCKIAVVMFIYFLATNYYWIL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 5746

Enviar un mensaje


PTH2R (Human) Recombinant Protein

PTH2R (Human) Recombinant Protein