Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
PTGDR (Human) Recombinant Protein
Abnova
PTGDR (Human) Recombinant Protein
Ref: AB-H00005729-G01
PTGDR (Human) Recombinant Protein
Contáctenos
Información del producto
Human PTGDR full-length ORF (NP_000944.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size
2 ug
Gene Name
PTGDR
Gene Alias
AS1|ASRT1|DP|DP1|MGC49004
Gene Description
prostaglandin D2 receptor (DP)
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key
AP
Immunogen Prot. Seq
MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSVFYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSSTLQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPGTWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCTRDCAEPRADGREASP
Form
Liquid
Recomended Dilution
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species
Human
Storage Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID
5729
Enviar un mensaje
PTGDR (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*