Ver mas grande
PLAUR (Human) Recombinant Protein
AB-H00005329-H02
Producto nuevo
PLAUR (Human) Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 2 ug |
| Gene Name | PLAUR |
| Gene Alias | CD87|UPAR|URKR |
| Gene Description | plasminogen activator, urokinase receptor |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Concentration | &ge |
| Immunogen Prot. Seq | LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDA |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Western Blot |
| Storage Buffer | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
| Host | Human HEK293H cells |
| Gene ID | 5329 |
Más información
Purified PLAUR (NP_002650.1 23 a.a. - 350 a.a.) human recombinant protein with His-Flag-StrepII tag at C-terminus expressed in human cells.