AB-H00005133-H01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 8 Biopuntos. Su cesta contiene un total 8 Biopuntos puede ser convertido en un Biobonos Descuento 32.00EUR.
Size | 25 ug |
Gene Name | PDCD1 |
Gene Alias | CD279|PD1|SLEB2|hPD-1|hPD-l |
Gene Description | programmed cell death 1 |
Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Concentration | &ge |
Application Key | WB,ELISA,SDS-PAGE,PI |
Immunogen Prot. Seq | NPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVT |
Form | Liquid |
Antigen species Target species | Human |
Quality control testing | SDS-PAGE and Western Blot |
Storage Buffer | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Host | Human HEK293T cells |
Gene ID | 5133 |