P2RX7 (Human) Recombinant Protein (P01)
  • P2RX7 (Human) Recombinant Protein (P01)

P2RX7 (Human) Recombinant Protein (P01)

Ref: AB-H00005027-P01
P2RX7 (Human) Recombinant Protein (P01)

Información del producto

Human P2RX7 full-length ORF ( AAH11913.1, 1 a.a. - 595 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name P2RX7
Gene Alias MGC20089|P2X7
Gene Description purinergic receptor P2X, ligand-gated ion channel, 7
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVHEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIE
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 5027

Enviar un mensaje


P2RX7 (Human) Recombinant Protein (P01)

P2RX7 (Human) Recombinant Protein (P01)