OXA1L (Human) Recombinant Protein (P01)
  • OXA1L (Human) Recombinant Protein (P01)

OXA1L (Human) Recombinant Protein (P01)

Ref: AB-H00005018-P01
OXA1L (Human) Recombinant Protein (P01)

Información del producto

Human OXA1L full-length ORF ( Q15070, 1 a.a. - 435 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name OXA1L
Gene Alias MGC133129
Gene Description oxidase (cytochrome c) assembly 1-like
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCRPHYLFLAASGPRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAELGLGSYTPVGLIQNLLEFMHVDLGLPWWGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFSSRIREAKLAGDHIEYYKASSEMALYQKKHGIKLYKPLILPVTQAPIFISFFIALREMANLPVPSLQTGGLWWFQD
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 5018

Enviar un mensaje


OXA1L (Human) Recombinant Protein (P01)

OXA1L (Human) Recombinant Protein (P01)