TNFRSF11B (Human) Recombinant Protein
  • TNFRSF11B (Human) Recombinant Protein

TNFRSF11B (Human) Recombinant Protein

Ref: AB-H00004982-H01
TNFRSF11B (Human) Recombinant Protein

Información del producto

Purified TNFRSF11B (AAH30155.1 24 a.a. - 194 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 25 ug
Gene Name TNFRSF11B
Gene Alias MGC29565|OCIF|OPG|TR1
Gene Description tumor necrosis factor receptor superfamily, member 11b
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq FPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQK
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293T cells
Gene ID 4982

Enviar un mensaje


TNFRSF11B (Human) Recombinant Protein

TNFRSF11B (Human) Recombinant Protein