GPR143 (Human) Recombinant Protein
  • GPR143 (Human) Recombinant Protein

GPR143 (Human) Recombinant Protein

Ref: AB-H00004935-G01
GPR143 (Human) Recombinant Protein

Información del producto

Human GPR143 full-length ORF (NP_000264.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name GPR143
Gene Alias OA1
Gene Description G protein-coupled receptor 143
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MTQAGRRGPGTPEPRPRTQPMASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENE
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 4935

Enviar un mensaje


GPR143 (Human) Recombinant Protein

GPR143 (Human) Recombinant Protein