SLC11A2 (Human) Recombinant Protein
  • SLC11A2 (Human) Recombinant Protein

SLC11A2 (Human) Recombinant Protein

Ref: AB-H00004891-G01
SLC11A2 (Human) Recombinant Protein

Información del producto

Human SLC11A2 full-length ORF (ACT64403.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name SLC11A2
Gene Alias DCT1|DMT1|FLJ37416|NRAMP2
Gene Description solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCFSFRKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWILLLATLVGLLLKRLAARLGVVTGLHLAEVCHRQYPKVPRVILWLMVELAIIGSDMQEVIGSAIAINLLSVGRIPLWGGVLITIADTFVFLFLDKYGLRKLEAFFGFLITIMALTFGYEYVTVKPSQSQVLKGMFVPSCSGCRTPQIEQ
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 4891

Enviar un mensaje


SLC11A2 (Human) Recombinant Protein

SLC11A2 (Human) Recombinant Protein