NPY5R (Human) Recombinant Protein (P01)
  • NPY5R (Human) Recombinant Protein (P01)

NPY5R (Human) Recombinant Protein (P01)

Ref: AB-H00004889-P01
NPY5R (Human) Recombinant Protein (P01)

Información del producto

Human NPY5R full-length ORF ( AAH42416, 1 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name NPY5R
Gene Alias NPYR5
Gene Description neuropeptide Y receptor Y5
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMI
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 4889

Enviar un mensaje


NPY5R (Human) Recombinant Protein (P01)

NPY5R (Human) Recombinant Protein (P01)