NPY5R (Human) Recombinant Protein
  • NPY5R (Human) Recombinant Protein

NPY5R (Human) Recombinant Protein

Ref: AB-H00004889-G01
NPY5R (Human) Recombinant Protein

Información del producto

Human NPY5R full-length ORF (NP_006165.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name NPY5R
Gene Alias NPYR5
Gene Description neuropeptide Y receptor Y5
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMI
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 4889

Enviar un mensaje


NPY5R (Human) Recombinant Protein

NPY5R (Human) Recombinant Protein