NPY1R (Human) Recombinant Protein
  • NPY1R (Human) Recombinant Protein

NPY1R (Human) Recombinant Protein

Ref: AB-H00004886-G01
NPY1R (Human) Recombinant Protein

Información del producto

Human NPY1R full-length ORF (AAH71720.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name NPY1R
Gene Alias NPYR
Gene Description neuropeptide Y receptor Y1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRS
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 4886

Enviar un mensaje


NPY1R (Human) Recombinant Protein

NPY1R (Human) Recombinant Protein