MC4R (Human) Recombinant Protein
  • MC4R (Human) Recombinant Protein

MC4R (Human) Recombinant Protein

Ref: AB-H00004160-G01
MC4R (Human) Recombinant Protein

Información del producto

Human MC4R full-length ORF (NP_005903.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name MC4R
Gene Alias MGC126851|MGC138197
Gene Description melanocortin 4 receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVGIIISCIWAACTVSGILFIIYSDSSAVIICLITMFFTMLALMASLYVHMFLMARLHIKRIAVLPGTGAIRQGANMKGAITLTILIGVFV
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 4160

Enviar un mensaje


MC4R (Human) Recombinant Protein

MC4R (Human) Recombinant Protein