MC3R (Human) Recombinant Protein (P01)
  • MC3R (Human) Recombinant Protein (P01)

MC3R (Human) Recombinant Protein (P01)

Ref: AB-H00004159-P01
MC3R (Human) Recombinant Protein (P01)

Información del producto

Human MC3R full-length ORF ( NP_063941.2, 1 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name MC3R
Gene Alias BMIQ9|MC3|MC3-R
Gene Description melanocortin 3 receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MSIQKTYLEGDFVFPVSSSSFLRTLLEPQLGSALLTAMNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVILAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIFDSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFIVYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHV
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 4159

Enviar un mensaje


MC3R (Human) Recombinant Protein (P01)

MC3R (Human) Recombinant Protein (P01)