LIPA (Human) Recombinant Protein (P01)
  • LIPA (Human) Recombinant Protein (P01)

LIPA (Human) Recombinant Protein (P01)

Ref: AB-H00003988-P01
LIPA (Human) Recombinant Protein (P01)

Información del producto

Human LIPA full-length ORF ( AAH12287, 1 a.a. - 399 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name LIPA
Gene Alias CESD|LAL
Gene Description lipase A, lysosomal acid, cholesterol esterase
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MKMRFLGLVVCLVLWPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKE
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 3988

Enviar un mensaje


LIPA (Human) Recombinant Protein (P01)

LIPA (Human) Recombinant Protein (P01)