LIFR (Human) Recombinant Protein
  • LIFR (Human) Recombinant Protein

LIFR (Human) Recombinant Protein

Ref: AB-H00003977-G01
LIFR (Human) Recombinant Protein

Información del producto

Human LIFR full-length ORF (AAI53097.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name LIFR
Gene Alias CD118|FLJ98106|FLJ99923|LIF-R|SJS2|STWS|SWS
Gene Description leukemia inhibitory factor receptor alpha
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MMDIYVCLKRPSWMVDNKRMRTASNFQWLLSTFILLYLMNQVNSQKKGAPHDLKCVTNNLQVWNCSWKAPSGTGRGTDYEVCIENRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGSSTSKFTLNEQNVSLIPDTPEILNLSADFSTSTLYLKWNDRGSVFPHRSNVIWEIKVLRKESMELVKLVTHNTTLNGKDTLHHWSWASDMPLECAIHFVEIRCYIDNLHFSGLEEWSDWSPVKNISWIPDSQTKVF
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3977

Enviar un mensaje


LIFR (Human) Recombinant Protein

LIFR (Human) Recombinant Protein