LAMP2 (Human) Recombinant Protein
  • LAMP2 (Human) Recombinant Protein

LAMP2 (Human) Recombinant Protein

Ref: AB-H00003920-G01
LAMP2 (Human) Recombinant Protein

Información del producto

Human LAMP2 full-length ORF (NP_054701.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name LAMP2
Gene Alias CD107b|LAMPB|LGP110
Gene Description lysosomal-associated membrane protein 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININ
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3920

Enviar un mensaje


LAMP2 (Human) Recombinant Protein

LAMP2 (Human) Recombinant Protein