LAG3 (Human) Recombinant Protein
  • LAG3 (Human) Recombinant Protein

LAG3 (Human) Recombinant Protein

Ref: AB-H00003902-G01
LAG3 (Human) Recombinant Protein

Información del producto

Human LAG3 full-length ORF (AAH52589.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name LAG3
Gene Alias CD223
Gene Description lymphocyte-activation gene 3
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMY
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3902

Enviar un mensaje


LAG3 (Human) Recombinant Protein

LAG3 (Human) Recombinant Protein