KIFC1 (Human) Recombinant Protein (P01)
  • KIFC1 (Human) Recombinant Protein (P01)

KIFC1 (Human) Recombinant Protein (P01)

Ref: AB-H00003833-P01
KIFC1 (Human) Recombinant Protein (P01)

Información del producto

Human KIFC1 full-length ORF ( NP_002254.1, 1 a.a. - 673 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name KIFC1
Gene Alias HSET|KNSL2|MGC1202|MGC149736|MGC149737
Gene Description kinesin family member C1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIATGLKNQKPVPAVPVQKSGTSGVPPMAGGKKPSKRPAWDLKGQLCDLNAELKRCRERTQTLDQENQQLQDQLRDAQQQVKALGTERTTLEGHLAKVQAQAEQGQQELKNLRACVLELEERLSTQEGLVQELQKKQVELQEERRGLMSQLEEKERRL
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 3833

Enviar un mensaje


KIFC1 (Human) Recombinant Protein (P01)

KIFC1 (Human) Recombinant Protein (P01)