KIT (Human) Recombinant Protein
  • KIT (Human) Recombinant Protein

KIT (Human) Recombinant Protein

Ref: AB-H00003815-G01
KIT (Human) Recombinant Protein

Información del producto

Human KIT full-length ORF (AAH71593.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name KIT
Gene Alias C-Kit|CD117|PBT|SCFR
Gene Description v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3815

Enviar un mensaje


KIT (Human) Recombinant Protein

KIT (Human) Recombinant Protein