KIR3DL1 (Human) Recombinant Protein
  • KIR3DL1 (Human) Recombinant Protein

KIR3DL1 (Human) Recombinant Protein

Ref: AB-H00003811-G01
KIR3DL1 (Human) Recombinant Protein

Información del producto

Human KIR3DL1 full-length ORF (NP_001077008.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name KIR3DL1
Gene Alias CD158E1|KIR|MGC119726|MGC119728|MGC126589|MGC126591|NKAT3|NKB1|NKB1B
Gene Description killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MLLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGLYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3811

Enviar un mensaje


KIR3DL1 (Human) Recombinant Protein

KIR3DL1 (Human) Recombinant Protein