KIR2DS1 (Human) Recombinant Protein
  • KIR2DS1 (Human) Recombinant Protein

KIR2DS1 (Human) Recombinant Protein

Ref: AB-H00003806-G01
KIR2DS1 (Human) Recombinant Protein

Información del producto

Human KIR2DS1 full-length ORF (AAI66637.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name KIR2DS1
Gene Alias CD158H|CD158a|p50.1
Gene Description killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MSLTVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMKQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLHVLIGTSVVKI
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3806

Enviar un mensaje


KIR2DS1 (Human) Recombinant Protein

KIR2DS1 (Human) Recombinant Protein