KCNH2 (Human) Recombinant Protein
  • KCNH2 (Human) Recombinant Protein

KCNH2 (Human) Recombinant Protein

Ref: AB-H00003757-G01
KCNH2 (Human) Recombinant Protein

Información del producto

Human KCNH2 full-length ORF (AAI67862.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name KCNH2
Gene Alias ERG1|HERG|HERG1|Kv11.1|LQT2|SQT1
Gene Description potassium voltage-gated channel, subfamily H (eag-related), member 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MAAPAGKASRTGALRPRAQKGRVRRAVRISSLVAQEVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEEGPPATECGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGK
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3757

Enviar un mensaje


KCNH2 (Human) Recombinant Protein

KCNH2 (Human) Recombinant Protein