JUNB (Human) Recombinant Protein (P01)
  • JUNB (Human) Recombinant Protein (P01)

JUNB (Human) Recombinant Protein (P01)

Ref: AB-H00003726-P01
JUNB (Human) Recombinant Protein (P01)

Información del producto

Human JUNB full-length ORF ( NP_002220.1, 1 a.a. - 347 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name JUNB
Gene Alias AP-1
Gene Description jun B proto-oncogene
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFKEEPQTVPEARSRDAT
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 3726

Enviar un mensaje


JUNB (Human) Recombinant Protein (P01)

JUNB (Human) Recombinant Protein (P01)