ITGA4 (Human) Recombinant Protein
  • ITGA4 (Human) Recombinant Protein

ITGA4 (Human) Recombinant Protein

Ref: AB-H00003676-G01
ITGA4 (Human) Recombinant Protein

Información del producto

Human ITGA4 full-length ORF (AAI56713.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name ITGA4
Gene Alias CD49D|IA4|MGC90518
Gene Description integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MAWEARREPGPRRAAVRETVMLLLCLGVPTGRPYNVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLDKQNQVKFGSYLGYSV
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3676

Enviar un mensaje


ITGA4 (Human) Recombinant Protein

ITGA4 (Human) Recombinant Protein