ITGA6 (Human) Recombinant Protein
  • ITGA6 (Human) Recombinant Protein

ITGA6 (Human) Recombinant Protein

Ref: AB-H00003655-G01
ITGA6 (Human) Recombinant Protein

Información del producto

Human ITGA6 full-length ORF (NP_000201.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name ITGA6
Gene Alias CD49f|DKFZp686J01244|FLJ18737|ITGA6B|VLA-6
Gene Description integrin, alpha 6
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLRGHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVGGETEHDESLVPVPAN
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3655

Enviar un mensaje


ITGA6 (Human) Recombinant Protein

ITGA6 (Human) Recombinant Protein