TNFRSF9 (Human) Recombinant Protein
  • TNFRSF9 (Human) Recombinant Protein

TNFRSF9 (Human) Recombinant Protein

Ref: AB-H00003604-H04
TNFRSF9 (Human) Recombinant Protein

Información del producto

Purified TNFRSF9 (AAH06196.1 46 a.a. - 128 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 2 ug
Gene Name TNFRSF9
Gene Alias 4-1BB|CD137|CDw137|ILA|MGC2172
Gene Description tumor necrosis factor receptor superfamily, member 9
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq SPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDAAFGTFNDQ
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293H cells
Gene ID 3604

Enviar un mensaje


TNFRSF9 (Human) Recombinant Protein

TNFRSF9 (Human) Recombinant Protein