IL13RA1 (Human) Recombinant Protein
  • IL13RA1 (Human) Recombinant Protein

IL13RA1 (Human) Recombinant Protein

Ref: AB-H00003597-G01
IL13RA1 (Human) Recombinant Protein

Información del producto

Human IL13RA1 full-length ORF (NP_001551.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name IL13RA1
Gene Alias CD213A1|IL-13Ra|NR4
Gene Description interleukin 13 receptor, alpha 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEWPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFIS
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3597

Enviar un mensaje


IL13RA1 (Human) Recombinant Protein

IL13RA1 (Human) Recombinant Protein