IL10RB (Human) Recombinant Protein
  • IL10RB (Human) Recombinant Protein

IL10RB (Human) Recombinant Protein

Ref: AB-H00003588-G01
IL10RB (Human) Recombinant Protein

Información del producto

Human IL10RB full-length ORF (NP_000619.3) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name IL10RB
Gene Alias CDW210B|CRF2-4|CRFB4|D21S58|D21S66|IL-10R2
Gene Description interleukin 10 receptor, beta
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYA
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3588

Enviar un mensaje


IL10RB (Human) Recombinant Protein

IL10RB (Human) Recombinant Protein