AB-H00003588-G01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Size | 10 ug |
Gene Name | IL10RB |
Gene Alias | CDW210B|CRF2-4|CRFB4|D21S58|D21S66|IL-10R2 |
Gene Description | interleukin 10 receptor, beta |
Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Application Key | AP |
Immunogen Prot. Seq | MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYA |
Form | Liquid |
Recomended Dilution | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Antigen species Target species | Human |
Storage Buffer | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene ID | 3588 |