CXCR2 (Human) Recombinant Protein
  • CXCR2 (Human) Recombinant Protein

CXCR2 (Human) Recombinant Protein

Ref: AB-H00003579-G01
CXCR2 (Human) Recombinant Protein

Información del producto

Human CXCR2 full-length ORF (NP_001548.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name CXCR2
Gene Alias CD182|CDw128b|CMKAR2|IL8R2|IL8RA|IL8RB
Gene Description chemokine (C-X-C motif) receptor 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHMGQKHRAMRVIFA
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3579

Enviar un mensaje


CXCR2 (Human) Recombinant Protein

CXCR2 (Human) Recombinant Protein