IL4R (Human) Recombinant Protein
  • IL4R (Human) Recombinant Protein

IL4R (Human) Recombinant Protein

Ref: AB-H00003566-G01
IL4R (Human) Recombinant Protein

Información del producto

Human IL4R full-length ORF (NP_001008699.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name IL4R
Gene Alias CD124|IL4RA
Gene Description interleukin 4 receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSNIC
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3566

Enviar un mensaje


IL4R (Human) Recombinant Protein

IL4R (Human) Recombinant Protein