Ver mas grande
IL2RG (Human) Recombinant Protein
AB-H00003561-G01
Producto nuevo
IL2RG (Human) Recombinant Protein
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | IL2RG |
| Gene Alias | CD132|IMD4|SCIDX|SCIDX1 |
| Gene Description | interleukin 2 receptor, gamma (severe combined immunodeficiency) |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Application Key | AP |
| Immunogen Prot. Seq | MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENP |
| Form | Liquid |
| Recomended Dilution | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Antigen species Target species | Human |
| Storage Buffer | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene ID | 3561 |
Más información
Human IL2RG full-length ORF (NP_000197.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
This product is belong to Proteoliposome (PL).