IGF1R (Human) Recombinant Protein
  • IGF1R (Human) Recombinant Protein

IGF1R (Human) Recombinant Protein

Ref: AB-H00003480-H01
IGF1R (Human) Recombinant Protein

Información del producto

Purified IGF1R (NP_000866.1 741 a.a. - 935 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 25 ug
Gene Name IGF1R
Gene Alias CD221|IGFIR|JTK13|MGC142170|MGC142172|MGC18216
Gene Description insulin-like growth factor 1 receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq DVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIH
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293H cells
Gene ID 3480

Enviar un mensaje


IGF1R (Human) Recombinant Protein

IGF1R (Human) Recombinant Protein