IGF1R (Human) Recombinant Protein
  • IGF1R (Human) Recombinant Protein

IGF1R (Human) Recombinant Protein

Ref: AB-H00003480-G01
IGF1R (Human) Recombinant Protein

Información del producto

Human IGF1R full-length ORF (NP_000866.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name IGF1R
Gene Alias CD221|IGFIR|JTK13|MGC142170|MGC142172|MGC18216
Gene Description insulin-like growth factor 1 receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYY
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3480

Enviar un mensaje


IGF1R (Human) Recombinant Protein

IGF1R (Human) Recombinant Protein