ICAM4 (Human) Recombinant Protein
  • ICAM4 (Human) Recombinant Protein

ICAM4 (Human) Recombinant Protein

Ref: AB-H00003386-G01
ICAM4 (Human) Recombinant Protein

Información del producto

Human ICAM4 full-length ORF (NP_001034221.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name ICAM4
Gene Alias CD242|LW
Gene Description intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGGDPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEPRAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLS
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3386

Enviar un mensaje


ICAM4 (Human) Recombinant Protein

ICAM4 (Human) Recombinant Protein