HTR7 (Human) Recombinant Protein
  • HTR7 (Human) Recombinant Protein

HTR7 (Human) Recombinant Protein

Ref: AB-H00003363-G01
HTR7 (Human) Recombinant Protein

Información del producto

Human HTR7 full-length ORF (NP_062874.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name HTR7
Gene Alias 5-HT7
Gene Description 5-hydroxytryptamine (serotonin) receptor 7 (adenylate cyclase-coupled)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVM
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3363

Enviar un mensaje


HTR7 (Human) Recombinant Protein

HTR7 (Human) Recombinant Protein