HTR4 (Human) Recombinant Protein (P01)
  • HTR4 (Human) Recombinant Protein (P01)

HTR4 (Human) Recombinant Protein (P01)

Ref: AB-H00003360-P01
HTR4 (Human) Recombinant Protein (P01)

Información del producto

Human HTR4 full-length ORF ( NP_000861.1, 1 a.a. - 388 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name HTR4
Gene Alias 5-HT4|5-HT4R
Gene Description 5-hydroxytryptamine (serotonin) receptor 4
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTET
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 3360

Enviar un mensaje


HTR4 (Human) Recombinant Protein (P01)

HTR4 (Human) Recombinant Protein (P01)