HTR1A (Human) Recombinant Protein
  • HTR1A (Human) Recombinant Protein

HTR1A (Human) Recombinant Protein

Ref: AB-H00003350-G01
HTR1A (Human) Recombinant Protein

Información del producto

Human HTR1A full-length ORF (NP_000515.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name HTR1A
Gene Alias 5-HT1A|5HT1a|ADRB2RL1|ADRBRL1
Gene Description 5-hydroxytryptamine (serotonin) receptor 1A
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQPKKSVN
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3350

Enviar un mensaje


HTR1A (Human) Recombinant Protein

HTR1A (Human) Recombinant Protein