HMGB2 (Human) Recombinant Protein
  • HMGB2 (Human) Recombinant Protein

HMGB2 (Human) Recombinant Protein

Ref: AB-H00003148-H01
HMGB2 (Human) Recombinant Protein

Información del producto

Purified HMGB2 (NP_002120.1, 1 a.a. - 209 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 2 ug
Gene Name HMGB2
Gene Alias HMG2
Gene Description high-mobility group box 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293T cells
Gene ID 3148

Enviar un mensaje


HMGB2 (Human) Recombinant Protein

HMGB2 (Human) Recombinant Protein