HCRTR2 (Human) Recombinant Protein
  • HCRTR2 (Human) Recombinant Protein

HCRTR2 (Human) Recombinant Protein

Ref: AB-H00003062-G01
HCRTR2 (Human) Recombinant Protein

Información del producto

Human HCRTR2 full-length ORF (NP_001517.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name HCRTR2
Gene Alias OX2R
Gene Description hypocretin (orexin) receptor 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKLWCRQI
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3062

Enviar un mensaje


HCRTR2 (Human) Recombinant Protein

HCRTR2 (Human) Recombinant Protein