GRPR (Human) Recombinant Protein
  • GRPR (Human) Recombinant Protein

GRPR (Human) Recombinant Protein

Ref: AB-H00002925-G01
GRPR (Human) Recombinant Protein

Información del producto

Human GRPR full-length ORF (NP_005305.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name GRPR
Gene Alias -
Gene Description gastrin-releasing peptide receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQSAYNLPVEGNIHVKKQ
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2925

Enviar un mensaje


GRPR (Human) Recombinant Protein

GRPR (Human) Recombinant Protein