GRM8 (Human) Recombinant Protein
  • GRM8 (Human) Recombinant Protein

GRM8 (Human) Recombinant Protein

Ref: AB-H00002918-G01
GRM8 (Human) Recombinant Protein

Información del producto

Human GRM8 full-length ORF (AAH93725.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name GRM8
Gene Alias FLJ41058|GLUR8|GPRC1H|MGC126724|MGLUR8|mGlu8
Gene Description glutamate receptor, metabotropic 8
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGERGVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPR
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2918

Enviar un mensaje


GRM8 (Human) Recombinant Protein

GRM8 (Human) Recombinant Protein