FFAR3 (Human) Recombinant Protein
  • FFAR3 (Human) Recombinant Protein

FFAR3 (Human) Recombinant Protein

Ref: AB-H00002865-G01
FFAR3 (Human) Recombinant Protein

Información del producto

Human FFAR3 full-length ORF (ABM82161.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name FFAR3
Gene Alias FFA3R|GPR41
Gene Description free fatty acid receptor 3
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTASDLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHPLWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAILLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGPYNVSHVVGYICGESP
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2865

Enviar un mensaje


FFAR3 (Human) Recombinant Protein

FFAR3 (Human) Recombinant Protein