LPAR4 (Human) Recombinant Protein
  • LPAR4 (Human) Recombinant Protein

LPAR4 (Human) Recombinant Protein

Ref: AB-H00002846-G01
LPAR4 (Human) Recombinant Protein

Información del producto

Human LPAR4 full-length ORF (NP_005287.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name LPAR4
Gene Alias GPR23|LPA4|P2RY9|P2Y5-LIKE|P2Y9
Gene Description lysophosphatidic acid receptor 4
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHM
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2846

Enviar un mensaje


LPAR4 (Human) Recombinant Protein

LPAR4 (Human) Recombinant Protein