PRLHR (Human) Recombinant Protein
  • PRLHR (Human) Recombinant Protein

PRLHR (Human) Recombinant Protein

Ref: AB-H00002834-G01
PRLHR (Human) Recombinant Protein

Información del producto

Human PRLHR full-length ORF (NP_004239.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name PRLHR
Gene Alias GPR10|GR3|MGC126539|MGC126541|PrRPR
Gene Description prolactin releasing hormone receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNR
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2834

Enviar un mensaje


PRLHR (Human) Recombinant Protein

PRLHR (Human) Recombinant Protein