GPR4 (Human) Recombinant Protein
  • GPR4 (Human) Recombinant Protein

GPR4 (Human) Recombinant Protein

Ref: AB-H00002828-G01
GPR4 (Human) Recombinant Protein

Información del producto

Human GPR4 full-length ORF (NP_005273.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name GPR4
Gene Alias -
Gene Description G protein-coupled receptor 4
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGNHTWEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVQQRNELGVYLMNLSIADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCCISVDRYLAVAHPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMEGWVAWMNLYRVFVGFLFPWALMLLSYRGILRAVRGSVSTERQEKAKIKRLALSLIAIVLVCFAPYHVLLLSRSAIYLGRP
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2828

Enviar un mensaje


GPR4 (Human) Recombinant Protein

GPR4 (Human) Recombinant Protein