CCR10 (Human) Recombinant Protein
  • CCR10 (Human) Recombinant Protein

CCR10 (Human) Recombinant Protein

Ref: AB-H00002826-G01
CCR10 (Human) Recombinant Protein

Información del producto

Human CCR10 full-length ORF (AAH98132.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name CCR10
Gene Alias GPR2
Gene Description chemokine (C-C motif) receptor 10
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLTVAALGLAGNGLVLATHLAARRAARSPTSAHLLQLALADLLLALTLPFAAAGALQGWSLGSATCRTISGLYSASFHAGFLFLACISADRYVAIARALPAGPRPSTPGRAHLVSVIVWLLSLLLALPALLFSQDGQREGQRRCRLIFPEGLTQTVKGASAVAQVALGFALPLGVMVACYALLGRTLLAARGPERRRALRVVVALVAA
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2826

Enviar un mensaje


CCR10 (Human) Recombinant Protein

CCR10 (Human) Recombinant Protein